Did you know that you can buy products from over 140 different suppliers from us?

ADP-Dependent Glucokinase (ADPGK) (N-Term) antibody

Details for Product No. ABIN501315
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ADPGK, 2610017G09Rik, ADP-GK, Adp-gk, C77577, RGD1306103
Epitope
N-Term
(4), (4), (2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(29), (19), (17), (3), (2)
Host
Rabbit
(25), (4)
Clonality
Polyclonal
Application
Western Blotting (WB)
(29), (14), (6), (2), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501315
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ADPGK
Sequence SILHSRNDLEEAFIHFMGKGAAAERFFSDKETFHDIAQVA SEFPGAQHYV
Predicted Reactivity Bovine : 100 %, Human : 100 %, Mouse : 90 %, Rat : 90 %, Guinea pig : 90 %, Horse : 80 %, Rabbit : 80 %, Dog : 70 %
Characteristics This is a rabbit polyclonal antibody against ADPGK. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ADPGK
Background ADPGK (EC 2.7.1.147) catalyzes the ADP-dependent phosphorylation of glucose to glucose-6-phosphate and may play a role in glycolysis, possibly during ischemic conditions. ADPGK (EC 2.7.1.147) catalyzes the ADP-dependent phosphorylation of glucose to glucose-6-phosphate and may play a role in glycolysis, possibly during ischemic conditions (Ronimus and Morgan, 2004 [PubMed 14975750]).
Molecular Weight 54 kDa
Gene ID 83440
NCBI Accession NM_031284, NP_112574
UniProt Q9BRR6
Research Area Signaling, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 496 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-ADP-Dependent Glucokinase (ADPGK) (N-Term) antibody WB Suggested Anti-ADPGK Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: COLO205 cell lysate
anti-ADP-Dependent Glucokinase (ADPGK) (N-Term) antibody (2) Host: Rabbit
Target Name: ADPGK
Sample Tissue: Human Fetal Brain
Antibody Dilution: 1.0 µg/mL
anti-ADP-Dependent Glucokinase (ADPGK) (N-Term) antibody (3) Host: Rabbit
Target Name: ADPGK
Sample Tissue: Human Fetal Liver
Antibody Dilution: 1.0 µg/mL
anti-ADP-Dependent Glucokinase (ADPGK) (N-Term) antibody (4) Host: Rabbit
Target Name: ADPGK
Sample Tissue: Human Fetal Lung
Antibody Dilution: 1.0 µg/mL
Background publications Lim, Hao, Shaw et al.: "A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration." in: Cell, Vol. 125, Issue 4, pp. 801-14, 2006 (PubMed).

Validation Images
back to top