Zinc Finger Protein 302 (ZNF302) (Middle Region) antibody

Details for Product No. ABIN501334
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms HSD16, MST154, MSTP154, ZNF135L, ZNF140L, ZNF327
Epitope
Middle Region
(2), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(11), (2), (2), (2), (2), (1), (1)
Host
Rabbit
(9), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(11), (2), (2)
Pubmed 1 reference available
Catalog no. ABIN501334
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZNF302
Sequence CMNCGKSFSRVSLLIQHLRIHTQEKRYECRICGKAFIHSS SLIHHQKSHT
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF302. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF302
Background ZNF302 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 7 C2H2-type zinc fingers and 1 KRAB domain. ZNF302 may be involved in transcriptional regulation.
Molecular Weight 46 kDa
Gene ID 55900
NCBI Accession NM_018443, NP_060913
UniProt Q9NR11-2
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 399 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Abrink, Aveskogh, Hellman: "Isolation of cDNA clones for 42 different Krüppel-related zinc finger proteins expressed in the human monoblast cell line U-937." in: DNA and cell biology, Vol. 14, Issue 2, pp. 125-36, 1995 (PubMed).

Hosts (9), (2)
Reactivities (11), (2), (2), (2), (2), (1), (1)
Applications (11), (2), (2)
Epitopes (2), (2), (2), (1), (1)
back to top