Translocase of Outer Mitochondrial Membrane 40 Homolog (Yeast)-Like (TOMM40L) antibody

Antigen: Translocase of Outer Mitochondrial Membrane 40 Homolog (Yeast)-Like (TOMM40L)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish, Xenopus laevis, Fruit Fly (Drosophila melanogaster)

Application: Western Blotting (WB)

Catalog no.: ABIN501406

Additional Information

Alternative name: TOMM40L

Gene ID: TOMM40L

UniProt: Q969M1

Immunogen: The immunogen for anti-TOMM40L antibody: synthetic peptide directed towards the middle region of human TOMM40L

Sequence: LNAQVLLLLAERLRAKAVFQTQQAKFLTWQFDGEYRGDDY TATLTLGNPD

Cross-Reactivity: Cow (Bovine), Dog (Canine), Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TOMM40L antibody concentration is 1 mg/ml.

Description: TOMM40L is a potential channel-forming protein implicated in import of protein precursors into mitochondria.

Characteristics: Antigen Size: 308 amino acids

Molecular Weight: 34kDa

Application Details

Application Notes: WB Suggested Anti-TOMM40L Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling, Metabolism, DNA/RNA

Restrictions: For Research Use only

Images

WB Suggested Anti-TOMM40L Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate

Publications

Product: Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).