Zinc Finger Protein 124 (ZNF124) antibody

Antigen: Zinc Finger Protein 124 (ZNF124)

Synonyms: HZF16, HZF-16, MGC117046

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Rat (Rattus), Mouse (Murine)

Application: Western Blotting (WB)

Catalog no.: ABIN501442

Additional Information

Alternative name: ZNF124

Gene ID: ZNF124

UniProt: B3KNP3

Immunogen: The immunogen for anti-ZNF124 antibody: synthetic peptide directed towards the middle region of human ZNF124

Sequence: KAFSCLSSLQGHIKAHAGEEPYPCKQCGKAFRYASSLQKH EKTHIAQKPY

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF124 antibody concentration is 1 mg/ml.

Description: The exact function of ZNF124 remains unknown.

Characteristics: Antigen Size: 289 amino acids

Molecular Weight: 33kDa

Application Details

Application Notes: WB Suggested Anti-ZNF124 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF124 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart

Publications

Product: Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).