Zinc Finger and BTB Domain Containing 44 (ZBTB44) antibody

Antigen: Zinc Finger and BTB Domain Containing 44 (ZBTB44)

Synonyms: BTBD15, ZNF851, HSPC063, MGC26123, MGC57431, MGC60348, MGC88058, btbd15, hspc063, MGC145247

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN501469

Additional Information

Alternative name: BTBD15 / ZBTB44

Gene ID: ZBTB44

Immunogen: The immunogen for anti-ZBTB44 antibody: synthetic peptide directed towards the middle region of human ZBTB44

Sequence: SRRKRKSYIVMSPESPVKCGTQTSSPQVLNSSASYSENRN QPVDSSLAFP

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZBTB44 antibody concentration is 1 mg/ml.

Description: ZBTB44 contains 1 BTB (POZ) domain and 4 C2H2-type zinc fingers. It may be involved in transcriptional regulation.

Characteristics: Antigen Size: 453 amino acids

Molecular Weight: 50kDa

Application Details

Application Notes: WB Suggested Anti-ZBTB44 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Hela cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ZBTB44 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Hela cell lysate

Publications

Product: Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).