Zinc Finger Protein 432 (ZNF432) (N-Term) antibody

Details for Product No. ABIN501474
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Epitope
N-Term
(3), (2), (1)
Reactivity
Human
(8), (1), (1), (1), (1)
Host
Rabbit
(7), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(6), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN501474
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF432
Sequence DERHSRICPENNEVDDHLQDHLENQRMLKSVEQYHEHNAF GNTASQTKSL
Predicted Reactivity Human :100 %,   Crab-eating macaque :80 %,  
Characteristics This is a rabbit polyclonal antibody against ZNF432. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF432
Background ZNF432 may be involved in transcriptional regulation.
Molecular Weight 75 kDa
Gene ID 9668
NCBI Accession NM_014650, NP_055465
UniProt O94892
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 652 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Zhan, Desiderio: "Nitroproteins from a human pituitary adenoma tissue discovered with a nitrotyrosine affinity column and tandem mass spectrometry." in: Analytical biochemistry, Vol. 354, Issue 2, pp. 279-89, 2006 (PubMed).

Hosts (7), (1)
Reactivities (8), (1), (1), (1), (1)
Applications (6), (2), (2), (1)
Epitopes (3), (2), (1)
back to top