Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 432 (ZNF432) (N-Term) antibody

Details for Product No. ABIN501474
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
(3), (2), (1)
Reactivity
Human
(8), (1), (1), (1), (1)
Host
Rabbit
(7), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(6), (2), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN501474
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF432
Sequence DERHSRICPENNEVDDHLQDHLENQRMLKSVEQYHEHNAF GNTASQTKSL
Predicted Reactivity Human :100 %,   Crab-eating macaque :80 %,  
Characteristics This is a rabbit polyclonal antibody against ZNF432. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF432
Background ZNF432 may be involved in transcriptional regulation.
Molecular Weight 75 kDa
Gene ID 9668
NCBI Accession NM_014650, NP_055465
UniProt O94892
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 652 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Zhan, Desiderio: "Nitroproteins from a human pituitary adenoma tissue discovered with a nitrotyrosine affinity column and tandem mass spectrometry." in: Analytical biochemistry, Vol. 354, Issue 2, pp. 279-89, 2006 (PubMed).

Hosts (7), (1)
Reactivities (8), (1), (1), (1), (1)
Applications (6), (2), (2), (1)
Epitopes (3), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501474
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top