PiggyBac Transposable Element Derived 1 (PGBD1) antibody

Antigen: PiggyBac Transposable Element Derived 1 (PGBD1)

Synonyms: SCAND4, HUCEP-4, dJ874C20.4, MGC102225, 4921509E05Rik, PGBD1, DKFZp469J1439

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN501502

Additional Information

Alternative name: PGBD1

Gene ID: PGBD1

UniProt: Q96JS3

Immunogen: The immunogen for anti-PGBD1 antibody: synthetic peptide directed towards the N terminal of human PGBD1

Sequence: YEALPGPAPENEDGLVKVKEEDPTWEQVCNSQEGSSHTQE ICRLRFRHFC

Cross-Reactivity: Cow (Bovine), Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-PGBD1 antibody concentration is 1 mg/ml.

Description: PGBD1 belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. This gene product is specifically expressed in the brain, however, its exact function is not known. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. This gene product is specifically expressed in the brain, however, its exact function is not known. The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. This gene product is specifically expressed in the brain, however, its exact function is not known.

Characteristics: Antigen Size: 809 amino acids

Molecular Weight: 92kDa

Application Details

Application Notes: WB Suggested Anti-PGBD1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-PGBD1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T cell lysate

Publications

Product: Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).