Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

PiggyBac Transposable Element Derived 1 (PGBD1) antibody

Antigen

PiggyBac Transposable Element Derived 1 (PGBD1)

Synonyms SCAND4, HUCEP-4, dJ874C20.4, MGC102225, 4921509E05Rik, PGBD1, DKFZp469J1439
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN501502
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name PGBD1
Gene ID PGBD1
UniProt Q96JS3
Immunogen The immunogen for anti-PGBD1 antibody: synthetic peptide directed towards the N terminal of human PGBD1
Sequence YEALPGPAPENEDGLVKVKEEDPTWEQVCNSQEGSSHTQE ICRLRFRHFC
Cross-Reactivity Cow (Bovine), Human
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-PGBD1 antibody concentration is 1 mg/ml.
Description PGBD1 belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. This gene product is specifically expressed in the brain, however, its exact function is not known. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. This gene product is specifically expressed in the brain, however, its exact function is not known. The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. This gene product is specifically expressed in the brain, however, its exact function is not known.
Characteristics Antigen Size: 809 amino acids
Molecular Weight 92kDa

Application Details

Application Notes WB Suggested Anti-PGBD1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).

Alternatives

Alternatives for antigen "PiggyBac Transposable Element Derived 1 (PGBD1)", type "Antibodies"
Hosts Rabbit (26), Goat (3)
Reactivities Human (27), Cow (Bovine) (1), Dog (Canine) (1), Fruit Fly (Drosophila melanogaster) (1)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (11), ELISA (8), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1)
Epitopes Internal Region (2), N-Term (2), C-Term (1), Internal Region,AA 346-375 (1)