Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501512

TGFB-Induced Factor Homeobox 2-Like, X-Linked (TGIF2LX) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TGIFLX
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501512
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TGIF2LX antibody: synthetic peptide directed towards the middle region of human TGIF2LX
Sequence KVKVSVTSPSSPELVSPEEHADFSSFLLLVDAAVQRAAEL ELEKKQEPNP
Predicted Reactivity Dog : 85%
Characteristics This is a rabbit polyclonal antibody against TGIF2LX. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TGIF2LX
Background TGIF2LX is a member of the TALE/TGIF homeobox family of transcription factors. Testis-specific expression suggests that this gene may play a role in spermatogenesis. This gene encodes a member of the TALE/TGIF homeobox family of transcription factors. Testis-specific expression suggests that this gene may play a role in spermatogenesis. A homolog of this gene lies within the male specific region of chromosome Y, in a block of sequence that is thought to be the result of a large X-to-Y transposition.
Molecular Weight 27kDa
Gene ID 90316
NCBI Accession NP_620410, NM_138960
UniProt Q8IUE1
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TGIF2LX antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Alternatives for antigen "TGFB-Induced Factor Homeobox 2-Like, X-Linked (TGIF2LX)", type "Antibodies"
Hosts (8), (2)
Reactivities (10)
Applications (10), (3), (2)
Epitopes (3), (3), (2), (1), (1)
Beacon