TGFB-Induced Factor Homeobox 2-Like, X-Linked (TGIF2LX) (Middle Region) antibody

Details for Product No. ABIN501512
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms TGIFLX
Epitope
Middle Region
(3), (2), (2), (1), (1)
Reactivity
Human
(10)
Host
Rabbit
(8), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(10), (2), (2)
Pubmed 1 reference available
Catalog no. ABIN501512
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human TGIF2LX
Sequence KVKVSVTSPSSPELVSPEEHADFSSFLLLVDAAVQRAAEL ELEKKQEPNP
Predicted Reactivity Dog : 85 %
Characteristics This is a rabbit polyclonal antibody against TGIF2LX. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TGIF2LX
Background TGIF2LX is a member of the TALE/TGIF homeobox family of transcription factors. Testis-specific expression suggests that this gene may play a role in spermatogenesis. This gene encodes a member of the TALE/TGIF homeobox family of transcription factors. Testis-specific expression suggests that this gene may play a role in spermatogenesis. A homolog of this gene lies within the male specific region of chromosome Y, in a block of sequence that is thought to be the result of a large X-to-Y transposition.
Molecular Weight 27 kDa
Gene ID 90316
NCBI Accession NM_138960, NP_620410
UniProt Q8IUE1
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 241 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-TGFB-Induced Factor Homeobox 2-Like, X-Linked (TGIF2LX) (Middle Region) antibody WB Suggested Anti-TGIF2LX Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
Background publications Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome...." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Hosts (8), (2)
Reactivities (10)
Applications (10), (2), (2)
Epitopes (3), (2), (2), (1), (1)
back to top