TGFB-Induced Factor Homeobox 2-Like, Y-Linked (TGIF2LY) (Middle Region) antibody

Details for Product No. ABIN501513
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TGIFLY
Epitope
Middle Region
(8), (7), (2), (2), (1)
Reactivity
Human
(12)
Host
Rabbit
(12)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(12), (6)
Pubmed 1 reference available
Catalog no. ABIN501513
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human TGIF2LY
Sequence RILPDMLQQRRNDPIIGHKTGKDAHATHLQSTEASVPAKS GPVVQTMYKA
Predicted Reactivity Human, Yeast
Characteristics This is a rabbit polyclonal antibody against TGIF2LY. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TGIF2LY
Background TGIF2LY is a member of the TALE/TGIF homeobox family of transcription factors. This gene lies within the male specific region of chromosome Y, in a block of sequence that is thought to be the result of a large X-to-Y transposition. The C-terminus of this
Molecular Weight 21 kDa
Gene ID 90655
NCBI Accession NM_139214, NP_631960
UniProt Q8IUE0
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 185 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-TGFB-Induced Factor Homeobox 2-Like, Y-Linked (TGIF2LY) (Middle Region) antibody WB Suggested Anti-TGIF2LY Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
Background publications Skaletsky, Kuroda-Kawaguchi, Minx et al.: "The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes." in: Nature, Vol. 423, Issue 6942, pp. 825-37, 2003 (PubMed).

Hosts (12)
Reactivities (12)
Applications (12), (6)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (8), (7), (2), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top