Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501513

TGFB-Induced Factor Homeobox 2-Like, Y-Linked (TGIF2LY) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TGIFLY
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501513
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TGIF2LY antibody: synthetic peptide directed towards the middle region of human TGIF2LY
Sequence RILPDMLQQRRNDPIIGHKTGKDAHATHLQSTEASVPAKS GPVVQTMYKA
Characteristics This is a rabbit polyclonal antibody against TGIF2LY. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TGIF2LY
Background TGIF2LY is a member of the TALE/TGIF homeobox family of transcription factors. This gene lies within the male specific region of chromosome Y, in a block of sequence that is thought to be the result of a large X-to-Y transposition. The C-terminus of this
Molecular Weight 21kDa
Gene ID 90655
NCBI Accession NP_631960, NM_139214
UniProt Q8IUE0
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TGIF2LY antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Skaletsky, Kuroda-Kawaguchi, Minx et al.: "The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes." in: Nature, Vol. 423, Issue 6942, pp. 825-37, 2003 (PubMed).

Alternatives for antigen "TGFB-Induced Factor Homeobox 2-Like, Y-Linked (TGIF2LY)", type "Antibodies"
Hosts (6)
Reactivities (6)
Applications (6), (1)
Epitopes (3), (2), (2), (1), (1)
Beacon