Atonal Homolog 7 (Drosophila) (ATOH7) antibody

Antigen: Atonal Homolog 7 (Drosophila) (ATOH7)

Synonyms: Math5, bHLHa13, ath5, zath5, ATH5, ATOH7

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN501515

Additional Information

Alternative name: ATOH7

Gene ID: ATOH7

UniProt: Q8N100

Immunogen: The immunogen for anti-ATOH7 antibody: synthetic peptide directed towards the C terminal of human ATOH7

Sequence: FGSERDWVGLHCEHFGRDHYLPFPGAKLPGESELYSQRLF GFQPEPFQMA

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ATOH7 antibody concentration is 1 mg/ml.

Description: ATOH7 is a transcription factor involved in the differentiation of retinal ganglion cells.ATOH7 is a member of the family of basic helix-loop-helix (bHLH) proteins with similarity to Drosophila 'atonal,' a proneural bHLH gene that controls photoreceptor development (Brown et al., 2002 [PubMed 11889557]).[supplied by OMIM].

Characteristics: Antigen Size: 152 amino acids

Molecular Weight: 17kDa

Application Details

Application Notes: WB Suggested Anti-ATOH7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: THP-1 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ATOH7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: THP-1 cell lysate

Publications

Product: McLellan, Langlands, Kealey: "Exhaustive identification of human class II basic helix-loop-helix proteins by virtual library screening." in: Mechanisms of development, Vol. 119 Suppl 1, pp. S285-91, 2003 (PubMed).