Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501522

Zinc Finger Protein 433 (ZNF433) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501522
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF433 antibody: synthetic peptide directed towards the N terminal of human ZNF433
Sequence VYGEVGSAHSSLNRHIRDDTGHKAYEYQEYGQKPYKCKYC KKPFNCLSSV
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against ZNF433. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF433
Background ZNF433 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 19 C2H2-type zinc fingers and 1 KRAB domain. ZNF433 may be involved in transcriptional regulation.
Molecular Weight 77kDa
Gene ID 163059
NCBI Accession NP_001073880, NM_001080411
UniProt Q8N7K0
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF433 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Zinc Finger Protein 433 (ZNF433)", type "Antibodies"
Hosts (9), (2)
Reactivities (11)
Applications (11), (3), (2), (2), (1)
Epitopes (6), (2), (2), (1), (1)
Beacon