Zinc Finger Protein 433 (ZNF433) (N-Term) antibody

Details for Product No. ABIN501522
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
(4), (2), (1), (1), (1)
Reactivity
Human
(11)
Host
Rabbit
(9), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(11), (2), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN501522
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF433
Sequence VYGEVGSAHSSLNRHIRDDTGHKAYEYQEYGQKPYKCKYC KKPFNCLSSV
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF433. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF433
Background ZNF433 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 19 C2H2-type zinc fingers and 1 KRAB domain. ZNF433 may be involved in transcriptional regulation.
Molecular Weight 77 kDa
Gene ID 163059
NCBI Accession NM_001080411, NP_001073880
UniProt Q8N7K0
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 673 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 433 (ZNF433) (N-Term) antibody WB Suggested Anti-ZNF433 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Hosts (9), (2)
Reactivities (11)
Applications (11), (2), (2), (2), (1)
Epitopes (4), (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top