Zinc Finger Protein 683 (ZNF683) antibody

Antigen: Zinc Finger Protein 683 (ZNF683)

Synonyms: MGC33414, RP11-569G9.6, ZNF683

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN501527

Additional Information

Alternative name: ZNF683

Gene ID: ZNF683

Immunogen: The immunogen for anti-ZNF683 antibody: synthetic peptide directed towards the N terminal of human ZNF683

Sequence: KEESAAQLGCCHRPMALGGTGGSLSPSLDFQLFRGDQVFS ACRPLPDMVD

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF683 antibody concentration is 1 mg/ml.

Description: This gene, ZNF683, which is located on chromosome 1, is predicted to encode a zinc finger protein, currently with unknown fucntion.

Characteristics: Antigen Size: 504 amino acids

Molecular Weight: 54kDa

Application Details

Application Notes: WB Suggested Anti-ZNF683 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF683 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysate

Publications

Product: Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).