Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501528

Zinc Finger Protein 619 (ZNF619) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501528
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF619 antibody: synthetic peptide directed towards the N terminal of human ZNF619
Sequence RLIVEGLLMDVPQHPDFKDRLEKSQLHDTGNKTKIGDCTD LTVQDHESST
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against ZNF619. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF619
Background ZNF619 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 10 C2H2-type zinc fingers. ZNF619 may be involved in transcriptional regulation.
Molecular Weight 63kDa
Gene ID 285267
NCBI Accession NP_775927, NM_173656
UniProt Q8N2I2
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF619 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Zinc Finger Protein 619 (ZNF619)", type "Antibodies"
Hosts (20)
Reactivities (20)
Applications (11), (10), (4), (3), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (2), (1)
Beacon