Did you know that you can buy products from over 140 different suppliers from us?

DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 26B (DDX26B) (N-Term) antibody

Details for Product No. ABIN501568
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ints6, zgc:63527, D130066O12, 4930535D10Rik, 6330505F04Rik
Epitope
N-Term
(1)
Reactivity
Mouse (Murine), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
(1)
Host
Rabbit
(2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN501568
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human DDX26B
Sequence ASTEPEQLGSVPTDESAITQMCEVTGGRSYCVRTQRMLNQ CLESLVQKVQ
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 100 %, Zebrafish : 100 %, Bovine : 90 %, Mouse : 90 %
Characteristics This is a rabbit polyclonal antibody against DDX26B. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name DDX26B
Background The function of this protein remains unknown.
Molecular Weight 97 kDa
Gene ID 203522
NCBI Accession NM_182540, NP_872346
UniProt Q5JSJ4
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 861 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 26B (DDX26B) (N-Term) antibody WB Suggested Anti-DDX26B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: THP-1 cell lysate
Background publications Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome...." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Hosts (2)
Reactivities (1)
Applications (2)
Epitopes (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501568
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top