Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501568

DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 26B (DDX26B) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ints6, zgc:63527, D130066O12, 4930535D10Rik, 6330505F04Rik
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501568
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DDX26B antibody: synthetic peptide directed towards the N terminal of human DDX26B
Sequence ASTEPEQLGSVPTDESAITQMCEVTGGRSYCVRTQRMLNQ CLESLVQKVQ
Predicted Reactivity Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Pig : 100%, Rabbit : 100%, Zebrafish : 100%, Bovine : 92%, Mouse : 92%
Characteristics This is a rabbit polyclonal antibody against DDX26B. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name DDX26B
Background The function of this protein remains unknown.
Molecular Weight 97kDa
Gene ID 203522
NCBI Accession NP_872346, NM_182540
UniProt Q5JSJ4
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DDX26B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Alternatives for antigen "DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 26B (DDX26B)", type "Antibodies"
Hosts (2)
Reactivities (1)
Applications (2)
Epitopes (1)
Beacon