Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501574

Gap Junction Protein, beta 6, 30kDa (GJB6) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CX30, DFNA3, DFNA3B, DFNB1B, ECTD2, ED2, EDH, HED, HED2, Cx30, AA958971, D14Bwg0506e, CX31, connexin-26, cx26, cx30, dfna3, dfna3a, dfnb1, dfnb1a, ed2, edh, gjb6, hed, nsrd1, ppk
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501574
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GJB6 antibody: synthetic peptide directed towards the middle region of human GJB6
Sequence CYLLLKVCFRRSKRAQTQKNHPNHALKESKQNEMNELISD SGQNAITGFP
Predicted Reactivity Mouse : 92%, Rat : 92%, Goat : 78%
Characteristics This is a rabbit polyclonal antibody against GJB6. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name GJB6
Background Gap junctions allow the transport of ions and metabolites between the cytoplasm of adjacent cells. They are formed by two hemichannels, made up of six connexin proteins assembled in groups. Each connexin protein has four transmembrane segments, two extrac
Molecular Weight 30kDa
Gene ID 10804
NCBI Accession NP_006774, NM_006783
UniProt O95452
Research Area Neurology
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GJB6 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications BuSaba, Cunningham: "Connexin 26 and 30 genes mutations in patients with chronic rhinosinusitis." in: The Laryngoscope, Vol. 118, Issue 2, pp. 310-3, 2008 (PubMed).

Alternatives for antigen "Gap Junction Protein, beta 6, 30kDa (GJB6)", type "Antibodies"
Hosts (31), (2), (2)
Reactivities (32), (20), (20), (20), (17), (17)
Applications (19), (15), (14), (10), (8), (4), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (3), (3), (2), (1), (1)
Beacon