Adenosine Deaminase, RNA-Specific (ADAR) antibody

Antigen: Adenosine Deaminase, RNA-Specific (ADAR)

Synonyms: DSH, G1P1, IFI4, p136, ADAR1, DRADA, DSRAD, IFI-4, K88dsRBP, red1, drada, wu:fc22a02, adar1, dsRAD, dsRAD-1, ADAR, EG:BACN35H14.1, cg12598, dADAR, hypnos-2, DmelCG12598, NV18763

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Rat (Rattus), Mouse (Murine)

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN501586

Additional Information

Alternative name: ADAR1 / DRADA

Gene ID: ADAR

UniProt: P55265

Immunogen: The immunogen for anti-ADAR antibody: synthetic peptide directed towards the C terminal of human ADAR

Sequence: RMGFTEVTPVTGASLRRTMLLLSRSPEAQPKTLPLTGSTF HDQIAMLSHR

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ADAR antibody concentration is 1 mg/ml.

Description: ADAR is responsible for RNA editing by site-specific deamination of adenosines. This enzyme destabilizes double stranded RNA through conversion of adenosine to inosine. Mutations in this gene have been associated with dyschromatosis symmetrica hereditaria. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.This gene encodes the enzyme responsible for RNA editing by site-specific deamination of adenosines. This enzyme destabilizes double stranded RNA through conversion of adenosine to inosine. Mutations in this gene have been associated with dyschromatosis symmetrica hereditaria. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Characteristics: Antigen Size: 1226 amino acids

Molecular Weight: 136kDa

Application Details

Application Notes: WB Suggested Anti-ADAR Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Muscle.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ADAR Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Muscle

Publications

Product: Pan, Ye, Franco et al.: "Insulin resistance and depressive symptoms in middle-aged and elderly Chinese: findings from the Nutrition and Health of Aging Population in China Study." in: Journal of affective disorders, Vol. 109, Issue 1-2, pp. 75-82, 2008 (PubMed).

Zhang, Liu, Jiang et al.: "Six novel mutations of the ADAR1 gene in Chinese patients with dyschromatosis symmetrica hereditaria." in: Journal of dermatological science, Vol. 50, Issue 2, pp. 109-14, 2008 (PubMed).