Adenosine Deaminase, RNA-Specific (ADAR) antibody
| Antigen | Adenosine Deaminase, RNA-Specific (ADAR) |
| Synonyms | DSH, G1P1, IFI4, p136, ADAR1, DRADA, DSRAD, IFI-4, K88dsRBP, red1, drada, wu:fc22a02, adar1, dsRAD, dsRAD-1, ADAR, EG:BACN35H14.1, cg12598, dADAR, hypnos-2, DmelCG12598, NV18763 |
| Clonality | Polyclonal |
| Host |
Alternatives Rabbit |
| Reactivity |
Alternatives Human, Rat (Rattus), Mouse (Murine) |
| Conjugate |
Alternatives Un-conjugated |
| Application |
Alternatives Western Blotting (WB) |
![]() |
2 references available |
| Catalog no. | ABIN501586 |
| Quantity | 50 µg (Variants) |
| Price | 317.90 $ Plus shipping costs $45.00 |
| Shipping to |
|
| Availability | Will be delivered in 2 to 3 Business Days |
Additional Information
| Alternative name | ADAR1 / DRADA |
| Gene ID | ADAR |
| UniProt | P55265 |
| Immunogen | The immunogen for anti-ADAR antibody: synthetic peptide directed towards the C terminal of human ADAR |
| Sequence | RMGFTEVTPVTGASLRRTMLLLSRSPEAQPKTLPLTGSTF HDQIAMLSHR |
| Cross-Reactivity | Human, Mouse (Murine), Rat (Rattus) |
| Format | Lyophilized |
| Reconstitution | Add 50 µl of distilled water. Final anti-ADAR antibody concentration is 1 mg/ml. |
| Description | ADAR is responsible for RNA editing by site-specific deamination of adenosines. This enzyme destabilizes double stranded RNA through conversion of adenosine to inosine. Mutations in this gene have been associated with dyschromatosis symmetrica hereditaria. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.This gene encodes the enzyme responsible for RNA editing by site-specific deamination of adenosines. This enzyme destabilizes double stranded RNA through conversion of adenosine to inosine. Mutations in this gene have been associated with dyschromatosis symmetrica hereditaria. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
| Characteristics | Antigen Size: 1226 amino acids |
| Molecular Weight | 136kDa |
Application Details
| Application Notes |
WB Suggested Anti-ADAR Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human Muscle. |
| Purification | Affinity Purified |
| Buffer | PBS |
| Storage (Long Term) | For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Storage (Short Term) | Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. |
| Restrictions | For Research Use only |
Images
|
WB Suggested Anti-ADAR Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human Muscle |
Publications
| Product |
Pan, Ye, Franco et al.: "Insulin resistance and depressive symptoms in middle-aged and elderly Chinese: findings from the Nutrition and Health of Aging Population in China Study." in: Journal of affective disorders, Vol. 109, Issue 1-2, pp. 75-82, 2008 (PubMed).
Zhang, Liu, Jiang et al.: "Six novel mutations of the ADAR1 gene in Chinese patients with dyschromatosis symmetrica hereditaria." in: Journal of dermatological science, Vol. 50, Issue 2, pp. 109-14, 2008 (PubMed). |
Alternatives
Alternatives for antigen "Adenosine Deaminase, RNA-Specific (ADAR)", type "Antibodies"
| Hosts | Rabbit (21), Sheep (2) |
| Reactivities | Human (20), Rat (Rattus) (12), Mouse (Murine) (10), Cat (Feline) (1), Chicken (1), Cow (Bovine) (1), Dog (Canine) (1) |
| Applications | Immunofluorescence (IF) (15), Western Blotting (WB) (10), ELISA (7), Immunohistochemistry (IHC) (6), Immunoprecipitation (IP) (2), Dot Blot (DB) (1), Immunocytochemistry (ICC) (1) |
| Conjugates | Alexa Fluor 350 (2), Alexa Fluor 488 (2), Alexa Fluor 555 (2), Alexa Fluor 647 (2), PE,Cy5.5 (2) |
| Epitopes | N-Term (5), C-Term (4) |




Alternatives