Did you know that you can buy products from over 140 different suppliers from us?

SCAN Domain Containing 3 (SCAND3) (N-Term) antibody

Details for Product No. ABIN501614
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Buster4, ZBED9, ZFP38-L, ZNF305P2, ZNF452, dJ1186N24.3
Epitope
N-Term
(3), (2), (1)
Reactivity
Mouse (Murine), Cow (Bovine), Human
(8), (1), (1), (1), (1)
Host
Rabbit
(8)
Clonality
Polyclonal
Application
Western Blotting (WB)
(8)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501614
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the n terminal of human ZNF452
Sequence EAVSRVFPALAGQAPEEQGEIIKVKVKEEDHTWDQESALR RNLSYTRELS
Predicted Reactivity Human :100 %,   Bovine :90 %,   Mouse :80 %,  
Characteristics This is a rabbit polyclonal antibody against ZNF452. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF452
Background ZNF452 (SCAND3) contains 1 integrase catalytic domain and 1 SCAN box domain. The function of ZNF452 remains unknown.
Molecular Weight 152 kDa
Gene ID 114821
NCBI Accession NM_052923, NP_443155
UniProt Q6R2W3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1325 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Validation Images
back to top