Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501614

SCAN Domain Containing 3 (SCAND3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Buster4, ZBED9, ZFP38-L, ZNF305P2, ZNF452, dJ1186N24.3
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501614
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF452 antibody: synthetic peptide directed towards the n terminal of human ZNF452
Sequence EAVSRVFPALAGQAPEEQGEIIKVKVKEEDHTWDQESALR RNLSYTRELS
Predicted Reactivity Human :100%,   Bovine :91%,   Mouse :83%,  
Characteristics This is a rabbit polyclonal antibody against ZNF452. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF452
Background ZNF452 (SCAND3) contains 1 integrase catalytic domain and 1 SCAN box domain. The function of ZNF452 remains unknown.
Molecular Weight 152kDa
Gene ID 114821
NCBI Accession NP_443155, NM_052923
UniProt Q6R2W3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF452 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives for antigen "SCAN Domain Containing 3 (SCAND3)", type "Antibodies"
Hosts (8)
Reactivities (7), (1), (1), (1), (1)
Applications (7), (2)
Epitopes (3), (2)
Beacon