Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Engrailed Homeobox 1 (EN1) antibody

Antigen

Engrailed Homeobox 1 (EN1)

Synonyms En-1, Mo-en.1, EN1
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Chicken, Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN501632
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name Engrailed-1 / EN1
Gene ID EN1
UniProt Q05925
Immunogen The immunogen for anti-EN1 antibody: synthetic peptide directed towards the middle region of human EN1
Sequence LNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHS TTTVQDKDES
Cross-Reactivity Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-EN1 antibody concentration is 1 mg/ml.
Description Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Differe
Characteristics Antigen Size: 392 amino acids
Molecular Weight 40kDa

Application Details

Application Notes WB Suggested Anti-EN1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: THP-1 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Atit, Sgaier, Mohamed et al.: "Beta-catenin activation is necessary and sufficient to specify the dorsal dermal fate in the mouse." in: Developmental biology, Vol. 296, Issue 1, pp. 164-76, 2006 (PubMed).

Alternatives

Alternatives for antigen "Engrailed Homeobox 1 (EN1)", type "Antibodies"
Hosts Rabbit (28), Mouse (4)
Reactivities Human (31), Mouse (Murine) (19), Rat (Rattus) (18), Chicken (1), Xenopus laevis (1), Zebrafish (1)
Applications Western Blotting (WB) (17), Immunofluorescence (IF) (15), ELISA (14), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (9), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes N-Term (3), Center (2), Internal Region (2), C-Term (1)