Nuclear Factor (erythroid-Derived 2)-Like 1 (NFE2L1) antibody

Antigen: Nuclear Factor (erythroid-Derived 2)-Like 1 (NFE2L1)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN501657

Additional Information

Alternative name: NFE2L1

Gene ID: NFE2L1

UniProt: Q14494

Immunogen: The immunogen for anti-NFE2L1 antibody: synthetic peptide directed towards the middle region of human NFE2L1

Sequence: FGRLRDENGRPYSPSQYALQYAGDGSVLLIPRTMADQQAR RQERKPKDRR

Cross-Reactivity: Cow (Bovine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-NFE2L1 antibody concentration is 1 mg/ml.

Description: NFE2L1 activates erythroid-specific, globin gene expression.This gene encodes a protein that is involved in globin gene expression in erythrocytes. Confusion has occurred in bibliographic databases due to the shared symbol of NRF1 for this gene, NFE2L1, and for 'nuclear respiratory factor 1' which has an official symbol of NRF1. Sequence Note: The RefSeq transcript and protein were derived from transcript and genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-256 DB097304.1 1-256 257-603 DA230932.1 224-570 604-1464 AK090459.1 569-1429 1465-3372 U08853.1 199-2106 3373-4349 AC004477.2 104176-105152 4350-4891 BM983473.1 1-542 c

Characteristics: Antigen Size: 772 amino acids

Molecular Weight: 85kDa

Application Details

Application Notes: WB Suggested Anti-NFE2L1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Spleen.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-NFE2L1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Spleen

Publications

Product: Wang, Kwok, Chan: "The p65 isoform of Nrf1 is a dominant negative inhibitor of ARE-mediated transcription." in: The Journal of biological chemistry, Vol. 282, Issue 34, pp. 24670-8, 2007 (PubMed).