Zinc Finger Protein 264 (ZNF264) antibody

Antigen: Zinc Finger Protein 264 (ZNF264)

Synonyms: ZNF460, ZNF264

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN501660

Additional Information

Alternative name: ZNF264

Gene ID: ZNF264

UniProt: O43296

Immunogen: The immunogen for anti-ZNF264 antibody: synthetic peptide directed towards the N terminal of human ZNF264

Sequence: AAAVLTDRAQVSVTFDDVAVTFTKEEWGQLDLAQRTLYQE VMLENCGLLV

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF264 antibody concentration is 1 mg/ml.

Description: ZNF264 may be involved in transcriptional regulation.

Characteristics: Antigen Size: 627 amino acids

Molecular Weight: 70kDa

Application Details

Application Notes: WB Suggested Anti-ZNF264 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors, DNA/RNA

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF264 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate

Publications

Product: Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).