Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Single-Minded Homolog 2 (Drosophila) (SIM2) antibody

Antigen

Single-Minded Homolog 2 (Drosophila) (SIM2)

Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish, Dog (Canine), Chicken, Pig (Porcine), Fruit Fly (Drosophila melanogaster)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN501700
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name SIM2
Gene ID SIM2
UniProt Q14190
Immunogen The immunogen for anti-SIM2 antibody: synthetic peptide directed towards the N terminal of human SIM2
Sequence MKEKSKNAAKTRREKENGEFYELAKLLPLPSAITSQLDKA SIIRLTTSYL
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-SIM2 antibody concentration is 1 mg/ml.
Description SIM1 and SIM2 genes are Drosophila single-minded (sim) gene homologs. The Drosophila sim gene encodes a transcription factor that is a master regulator of fruit fly neurogenesis. SIM2 maps within the so-called Down syndrome chromosomal region. Based on t
Characteristics Antigen Size: 667 amino acids
Molecular Weight 73kDa

Application Details

Application Notes WB Suggested Anti-SIM2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human kidney.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Laffin, Wellberg, Kwak et al.: "Loss of singleminded-2s in the mouse mammary gland induces an epithelial-mesenchymal transition associated with up-regulation of slug and matrix metalloprotease 2." in: Molecular and cellular biology, Vol. 28, Issue 6, pp. 1936-46, 2008 (PubMed).

Alternatives

Alternatives for antigen "Single-Minded Homolog 2 (Drosophila) (SIM2)", type "Antibodies"
Hosts Rabbit (26), Goat (3), Mouse (3)
Reactivities Human (30), Mouse (Murine) (23), Rat (Rattus) (22)
Applications Immunofluorescence (IF) (16), Western Blotting (WB) (15), ELISA (13), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunocytochemistry (ICC) (1), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1)
Epitopes AA 372-384 (1), AA 426-526 (1), Internal Region (1), N-Term (1)