Structural Maintenance of Chromosomes 1A (SMC1A) antibody

Antigen: Structural Maintenance of Chromosomes 1A (SMC1A)

Synonyms: SMC1, SMCB, CDLS2, SB1.8, SMC1L1, DXS423E, KIAA0178, MGC138332, SMC1alpha, DKFZp686L19178, SMC-1A, smc1a, smc1l1, zgc:76902, im:7158706, SMC1A, SMC1L2, bK268H5, FLJ43748, SMC1BETA, bK268H5.5, NV15570

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Dog (Canine), Xenopus laevis, Zebrafish

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN501738

Additional Information

Alternative name: SMC1A / SMC1

Gene ID: SMC1A

UniProt: Q14683

Immunogen: The immunogen for anti-SMC1A antibody: synthetic peptide directed towards the C terminal of human SMC1A

Sequence: VISLKEEFYTKAESLIGVYPEQGDCVISKVLTFDLTKYPD ANPNPNEQ

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SMC1A antibody concentration is 1 mg/ml.

Description: The cohesin multiprotein complex is required for sister chromatid cohesion. This complex is composed partly of two structural maintenance of chromosomes (SMC) proteins, SMC3 and either SMC1L2 or the protein encoded by SMC1A gene. Most of the cohesin complexes dissociate from the chromosomes before mitosis, although those complexes at the kinetochore remain. Therefore, the SMC1A protein is thought to be an important part of functional kinetochores. In addition, this protein interacts with BRCA1 and is phosphorylated by ATM, indicating a potential role for this protein in DNA repair. Proper cohesion of sister chromatids is a prerequisite for the correct segregation of chromosomes during cell division. The cohesin multiprotein complex is required for sister chromatid cohesion. This complex is composed partly of two structural maintenance of chromosomes (SMC) proteins, SMC3 and either SMC1L2 or the protein encoded by this gene. Most of the cohesin complexes dissociate from the chromosomes before mitosis, although those complexes at the kinetochore remain. Therefore, the encoded protein is thought to be an important part of functional kinetochores. In addition, this protein interacts with BRCA1 and is phosphorylated by ATM, indicating a potential role for this protein in DNA repair. This gene, which belongs to the SMC gene family, is located in an area of the X-chromosome that escapes X inactivation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 1233 amino acids

Molecular Weight: 143kDa

Application Details

Application Notes: WB Suggested Anti-SMC1A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SMC1A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T cell lysate

Publications

Product: Barber, McManus, Yuen et al.: "Chromatid cohesion defects may underlie chromosome instability in human colorectal cancers." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 105, Issue 9, pp. 3443-8, 2008 (PubMed).