Chromosome 16 Open Reading Frame 80 (C16orf80) antibody

Antigen: Chromosome 16 Open Reading Frame 80 (C16orf80)

Synonyms: C20H16orf80, GTL3, EVORF, fSAP23

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Fruit Fly (Drosophila melanogaster), Rat (Rattus), Chicken, Xenopus laevis, Zebrafish, Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN501766

Additional Information

Alternative name: GTL3 / C16orf80

Gene ID: C16orf80

UniProt: Q9Y6A4

Immunogen: The immunogen for anti-C16orf80 antibody: synthetic peptide directed towards the middle region of human C16orf80

Sequence: AYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFK LYLPVQNKAK

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-C16orf80 antibody concentration is 1 mg/ml.

Description: The specific function of C16orf80 is not yet known.

Characteristics: Antigen Size: 193 amino acids

Molecular Weight: 23kDa

Application Details

Application Notes: WB Suggested Anti-C16orf80 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-C16orf80 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta

Publications

Product: Jin, Smith, Stark et al.: "Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization." in: Current biology : CB, Vol. 14, Issue 16, pp. 1436-50, 2004 (PubMed).