Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501776

Zinc Finger Protein 423 (104125) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Ebfaz, Roaz, Zfp104, Znf423, ataxia1, mKIAA0760, nur12, si:ch211-212o1.3, wu:fc95d03, ebfaz, oaz, roaz, zfp104, zfp423, JBTS19, NPHP14, OAZ, ZFP423
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501776
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF423 antibody: synthetic peptide directed towards the middle region of human ZNF423
Sequence CFTVFVQANKLQQHIFAVHGQEDKIYDCSQCPQKFFFQTE LQNHTMSQHA
Predicted Reactivity Bovine : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Rabbit : 100%, African clawed frog : 92%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against ZNF423. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF423
Background ZNF423 is the transcription factor that can both act as an activator or a repressor depending on the context. ZNF423 plays a central role in BMP signaling and olfactory neurogenesis. ZNF423 is associates with SMADs in response to BMP2 leading to activate
Molecular Weight 144kDa
Gene ID 23090
NCBI Accession NP_055884, NM_015069
UniProt Q2M1K9
Research Area Chromatin and Nuclear Signaling, Transcription Factors, Chromatin Binding Proteins
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF423 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).

Alternatives for antigen "Zinc Finger Protein 423 (104125)", type "Antibodies"
Hosts (26), (3), (1)
Reactivities (29), (25), (24), (24), (24), (24), (12)
Applications (20), (10), (9), (6), (1), (1)
Conjugates (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (2), (1)
Beacon