Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Zinc Finger Protein 423 (104125) antibody

Antigen

Zinc Finger Protein 423 (104125)

Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish, Dog (Canine)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN501776
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name ZNF423
Gene ID ZNF423
UniProt Q2M1K9
Immunogen The immunogen for anti-ZNF423 antibody: synthetic peptide directed towards the middle region of human ZNF423
Sequence CFTVFVQANKLQQHIFAVHGQEDKIYDCSQCPQKFFFQTE LQNHTMSQHA
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-ZNF423 antibody concentration is 1 mg/ml.
Description ZNF423 is the transcription factor that can both act as an activator or a repressor depending on the context. ZNF423 plays a central role in BMP signaling and olfactory neurogenesis. ZNF423 is associates with SMADs in response to BMP2 leading to activate
Characteristics Antigen Size: 1284 amino acids
Molecular Weight 144kDa

Application Details

Application Notes WB Suggested Anti-ZNF423 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HT1080 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, Transcription Factors, Chromatin Binding Proteins
Restrictions For Research Use only

Publications

Product Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).

Alternatives

Alternatives for antigen "Zinc Finger Protein 423 (104125)", type "Antibodies"
Hosts Rabbit (38), Goat (2), Mouse (1)
Reactivities Human (40), Mouse (Murine) (37), Cow (Bovine) (36), Rat (Rattus) (36), Zebrafish (Danio rerio) (36), Dog (Canine) (18), Pig (Porcine) (18), Sheep (Ovine) (18)
Applications Immunofluorescence (IF) (30), Western Blotting (WB) (9), ELISA (8), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (6), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (6), Immunoelectron Microscopy (IEM) (2), Immunohistochemistry (IHC) (1), Immunostaining (ISt) (1)
Conjugates Alexa Fluor 350 (2), Alexa Fluor 488 (2), Alexa Fluor 555 (2), Alexa Fluor 647 (2), Biotin (2), Cy3 (2), Cy5 (2), Cy5.5 (2), Cy7 (2), FITC (2), Gold (2), HRP (2), PE (2), PE-Cy3 (2), PE-Cy5 (2), PE-Cy5.5 (2), PE-Cy7 (2), Un-conjugated (2)
Epitopes AA 901-945 (18), Internal Region (1), N-Term (1)