Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 691 (ZNF691) (Middle Region) antibody

Details for Product No. ABIN501783
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Zfp691, RGD1308150, Znf691, 6430544H17Rik, ZNF691
Epitope
Middle Region
(7), (4), (3), (2), (1), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Dog (Canine), Cow (Bovine), Human
(19), (1), (1)
Host
Rabbit
(18), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(19), (9), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN501783
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZNF691
Sequence SDISNFGAHQRTHRGEKPYRCTVCGKHFSRSSNLIRHQKT HLGEQAGKDS
Predicted Reactivity Dog : 100 %, Human : 100 %, Rabbit : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF691. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF691
Background ZNF691 may be involved in transcriptional regulation.
Molecular Weight 32 kDa
Gene ID 51058
NCBI Accession NM_015911, NP_056995
UniProt Q5VV52-2
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 284 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501783
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top