Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501783

Zinc Finger Protein 691 (ZNF691) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Zfp691, RGD1308150, Znf691, 6430544H17Rik, ZNF691
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501783
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF691 antibody: synthetic peptide directed towards the middle region of human ZNF691
Sequence SDISNFGAHQRTHRGEKPYRCTVCGKHFSRSSNLIRHQKT HLGEQAGKDS
Predicted Reactivity Dog : 100%, Human : 100%, Rabbit : 100%
Characteristics This is a rabbit polyclonal antibody against ZNF691. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF691
Background ZNF691 may be involved in transcriptional regulation.
Molecular Weight 32kDa
Gene ID 51058
NCBI Accession NP_056995, NM_015911
UniProt Q5VV52-2
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF691 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Alternatives for antigen "Zinc Finger Protein 691 (ZNF691)", type "Antibodies"
Hosts (10), (1)
Reactivities (11), (1), (1)
Applications (11), (1), (1)
Epitopes (4), (2), (2), (1), (1), (1)
Beacon