Zinc Finger Protein 691 (ZNF691) antibody

Antigen: Zinc Finger Protein 691 (ZNF691)

Synonyms: Zfp691, RP11-342M1.5, RGD1308150, ZNF691, MGC139625

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Rat (Rattus), Mouse (Murine), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN501783

Additional Information

Alternative name: ZNF691

Gene ID: ZNF691

UniProt: Q5VV52-2

Immunogen: The immunogen for anti-ZNF691 antibody: synthetic peptide directed towards the middle region of human ZNF691

Sequence: SDISNFGAHQRTHRGEKPYRCTVCGKHFSRSSNLIRHQKT HLGEQAGKDS

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF691 antibody concentration is 1 mg/ml.

Description: ZNF691 may be involved in transcriptional regulation.

Characteristics: Antigen Size: 284 amino acids

Molecular Weight: 32kDa

Application Details

Application Notes: WB Suggested Anti-ZNF691 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF691 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain

Publications

Product: Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).