Zinc Finger Protein 302 (ZNF302) antibody

Antigen: Zinc Finger Protein 302 (ZNF302)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Fruit Fly (Drosophila melanogaster), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN501802

Additional Information

Alternative name: ZNF302

Gene ID: ZNF302

UniProt: Q9NR11-2

Immunogen: The immunogen for anti-ZNF302 antibody: synthetic peptide directed towards the N terminal of human ZNF302

Sequence: MSQVTFSDVAIDFSHEEWACLDSAQRDLYKDVMVQNYENL VSVGLSVTKP

Cross-Reactivity: Cow (Bovine), Dog (Canine), Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF302 antibody concentration is 1 mg/ml.

Description: ZNF302 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 7 C2H2-type zinc fingers and 1 KRAB domain. ZNF302 may be involved in transcriptional regulation.

Characteristics: Antigen Size: 399 amino acids

Molecular Weight: 46kDa

Application Details

Application Notes: WB Suggested Anti-ZNF302 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Thymus.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF302 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Thymus

Publications

Product: Abrink, Aveskogh, Hellman: "Isolation of cDNA clones for 42 different Krüppel-related zinc finger proteins expressed in the human monoblast cell line U-937." in: DNA and cell biology, Vol. 14, Issue 2, pp. 125-36, 1995 (PubMed).