Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501825

Neurogenic Differentiation 4 (NEUROD4) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AI846749, ATH-3, Atoh3, MATH-3, Math3, bHLHa4, ath3, zath3, ath-3, atoh3, bhlha4, math-3, xath-3, ATH3
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501825
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NEUROD4 antibody: synthetic peptide directed towards the middle region of human NEUROD4
Sequence PHYPSSSLSSGHVHSTPFQAGTPRYDVPIDMSYDSYPHHG IGTQLNTVFT
Predicted Reactivity Human : 100%, Dog : 92%, Rat : 92%, Bovine : 85%, Mouse : 85%
Characteristics This is a rabbit polyclonal antibody against NEUROD4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name NEUROD4
Background The specific function of the protein remains unknown.
Molecular Weight 37kDa
Gene ID 58158
NCBI Accession NP_067014, NM_021191
UniProt Q9HD90
Research Area Neurology, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NEUROD4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Horikawa, Horikawa, Cox et al.: "beta-cell transcription factors and diabetes: no evidence for diabetes-associated mutations in the gene encoding the basic helix-loop-helix transcription factor neurogenic differentiation 4 (NEUROD4) in Japanese patients with MODY." in: Diabetes, Vol. 49, Issue 11, pp. 1955-7, 2000 (PubMed).

Alternatives for antigen "Neurogenic Differentiation 4 (NEUROD4)", type "Antibodies"
Hosts (4), (4)
Reactivities (8), (1), (1), (1), (1), (1), (1), (1), (1)
Applications (7), (3), (1), (1)
Epitopes (3), (2), (1)
Beacon