Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 671 (ZNF671) (N-Term) antibody

Details for Product No. ABIN501848
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF671
Epitope
N-Term
(3), (1), (1)
Reactivity
Human
(9)
Host
Rabbit
(8), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(8), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN501848
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF671
Sequence MLSPVSRDASDALQGRKCLRPRSRRLPLPAAVRAHGPMAE LTDSARGCVV
Predicted Reactivity Human
Characteristics This is a rabbit polyclonal antibody against ZNF671. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF671
Background ZNF671 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 10 C2H2-type zinc fingers and 1 KRAB domain. ZNF671 may be involved in transcriptional regulation.
Molecular Weight 61 kDa
Gene ID 79891
NCBI Accession NM_018300, NP_079109
UniProt Q8TAW3
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 534 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 671 (ZNF671) (N-Term) antibody WB Suggested Anti-ZNF671 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: OVCAR-3 cell lysate
Background publications Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501848
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top