Zinc Finger Protein 671 (ZNF671) antibody

Antigen: Zinc Finger Protein 671 (ZNF671)

Synonyms: FLJ23506, ZNF671

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN501848

Additional Information

Alternative name: ZNF671

Gene ID: ZNF671

UniProt: Q8TAW3

Immunogen: The immunogen for anti-ZNF671 antibody: synthetic peptide directed towards the N terminal of human ZNF671

Sequence: MLSPVSRDASDALQGRKCLRPRSRRLPLPAAVRAHGPMAE LTDSARGCVV

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF671 antibody concentration is 1 mg/ml.

Description: ZNF671 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 10 C2H2-type zinc fingers and 1 KRAB domain. ZNF671 may be involved in transcriptional regulation.

Characteristics: Antigen Size: 534 amino acids

Molecular Weight: 61kDa

Application Details

Application Notes: WB Suggested Anti-ZNF671 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: OVCAR-3 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF671 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: OVCAR-3 cell lysate

Publications

Product: Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).