Mitochondrial Ribosomal Protein S15 (MRPS15) antibody

Antigen: Mitochondrial Ribosomal Protein S15 (MRPS15)

Synonyms: DC37, S15mt, RPMS15, MPR-S15, FLJ11564, CG4207, DmelCG4207, DmMRPS15, MRP-S15, mRpS15, Mprs15, 1500003E24Rik, 2410002B11Rik, MGC95073, mrps15

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN501855

Additional Information

Alternative name: MRPS15

Gene ID: MRPS15

UniProt: P82914

Immunogen: The immunogen for anti-MRPS15 antibody: synthetic peptide directed towards the N terminal of human MRPS15

Sequence: FNQWGLQPRSLLLQAARGYVVRKPAQSRLDDDPPPSTLLK DYQNVPGIEK

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-MRPS15 antibody concentration is 1 mg/ml.

Description: Mammalian mitochondrial ribosomal proteins help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPS15 is a 28S subunit protein that belongs to the ribosomal pr

Characteristics: Antigen Size: 257 amino acids

Molecular Weight: 30kDa

Application Details

Application Notes: WB Suggested Anti-MRPS15 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Thymus.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, DNA/RNA

Restrictions: For Research Use only

Images

WB Suggested Anti-MRPS15 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Thymus

Publications

Product: Zhang, Gerstein: "Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome." in: Genomics, Vol. 81, Issue 5, pp. 468-80, 2003 (PubMed).