Cyclin B3 (CCNB3) antibody

Antigen: Cyclin B3 (CCNB3)

Synonyms: anon-WO0118547.414, CG5814, Cyc B3, cycB3, DmelCG5814, l(3)L6540, RGD1564367, ccnb3-a, MGC52520, MGC130810, CYCB3, ccnb3, MGC153369, MGC174595, MGC154490, NV16541, CCNB3

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN501865

Additional Information

Alternative name: Cyclin B3

Gene ID: CCNB3

UniProt: Q8WWL7

Immunogen: The immunogen for anti-CCNB3 antibody: synthetic peptide directed towards the C terminal of human CCNB3

Sequence: ISELHPLVRQLNKLLTFSSYDSLKAVYYKYSHPVFFEVAK IPALDMLKLE

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-CCNB3 antibody concentration is 1 mg/ml.

Description: CCNB3 belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. Studies of similar genes in chick and Drosophila suggest that this cyclin may associate with CDC2 and CDK2 kinases, and be required for proper spindle reorganization and restoration of the interphase nucleus. Two transcript variants encoding different isoforms have been found for this gene. The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. Studies of similar genes in chick and Drosophila suggest that this cyclin may associate with CDC2 and CDK2 kinases, and be required for proper spindle reorganization and restoration of the interphase nucleus. Two transcript variants encoding different isoforms have been found for this gene.

Characteristics: Antigen Size: 1395 amino acids

Molecular Weight: 158kDa

Application Details

Application Notes: WB Suggested Anti-CCNB3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Cell Cycle

Restrictions: For Research Use only

Images

WB Suggested Anti-CCNB3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle

Publications

Product: Cheng, Kapranov, Drenkow et al.: "Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution." in: Science (New York, N.Y.), Vol. 308, Issue 5725, pp. 1149-54, 2005 (PubMed).