Zinc Finger Protein 682 (ZNF682) antibody

Antigen: Zinc Finger Protein 682 (ZNF682)

Synonyms: FLJ90362, BC39498_3, ZNF682

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN501868

Additional Information

Alternative name: ZNF682

Gene ID: ZNF682

UniProt: O95780

Immunogen: The immunogen for anti-ZNF682 antibody: synthetic peptide directed towards the middle region of human ZNF682

Sequence: KGFVDILTYIHTMNVMITNTNNGWKYFCPICGRLFNTYSE LRQHSCSSSG

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF682 antibody concentration is 1 mg/ml.

Description: ZNF682 contains 1 KRAB domain and 11 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. ZNF682 may be involved in transcriptional regulation.

Characteristics: Antigen Size: 498 amino acids

Molecular Weight: 58kDa

Application Details

Application Notes: WB Suggested Anti-ZNF682 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Lung.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF682 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Lung

Publications

Product: Grimwood, Gordon, Olsen et al.: "The DNA sequence and biology of human chromosome 19." in: Nature, Vol. 428, Issue 6982, pp. 529-35, 2004 (PubMed).