Tripartite Motif Containing 14 (TRIM14) antibody

Antigen: Tripartite Motif Containing 14 (TRIM14)

Synonyms: KIAA0129, pub, 5830400N10Rik, TRIM14

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN501869

Additional Information

Alternative name: TRIM14

Gene ID: TRIM14

UniProt: Q14142-2

Immunogen: The immunogen for anti-TRIM14 antibody: synthetic peptide directed towards the middle region of human TRIM14

Sequence: LSFEPVKSFFKGLVEAVESTLQTPLDIRLSPTNHAYSALK VSSPRLVSNR

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TRIM14 antibody concentration is 1 mg/ml.

Description: TRIM14 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies and its function has not been de

Characteristics: Antigen Size: 253 amino acids

Molecular Weight: 28kDa

Application Details

Application Notes: WB Suggested Anti-TRIM14 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: THP-1 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TRIM14 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: THP-1 cell lysate

Publications

Product: Humphray, Oliver, Hunt et al.: "DNA sequence and analysis of human chromosome 9." in: Nature, Vol. 429, Issue 6990, pp. 369-74, 2004 (PubMed).