Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501910

Oligodendrocyte Transcription Factor 3 (OLIG3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms OLIG2, Bhlhb7, bHLHe20, olig3, wu:fc45e02, zgc:110483, OLIG3, bhlhb7, MGC89336
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501910
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-OLIG3 antibody: synthetic peptide directed towards the N terminal of human OLIG3
Sequence MNSDSSSVSSRASSPDMDEMYLRDHHHRHHHHQESRLNSV SSTQGDMMQK
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against OLIG3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name OLIG3
Background OLIG3 may determine the distinct specification program of class A neurons in the dorsal part of the spinal cord and suppress specification of class B neurons.
Molecular Weight 29kDa
Gene ID 167826
NCBI Accession NP_786923, NM_175747
UniProt Q7RTU3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-OLIG3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Plenge, Cotsapas, Davies et al.: "Two independent alleles at 6q23 associated with risk of rheumatoid arthritis." in: Nature genetics, Vol. 39, Issue 12, pp. 1477-82, 2007 (PubMed).

Alternatives for antigen "Oligodendrocyte Transcription Factor 3 (OLIG3)", type "Antibodies"
Hosts (29), (2)
Reactivities (29), (18), (14)
Applications (22), (10), (8), (8), (7), (3), (3), (2), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (4), (2), (2), (1), (1), (1), (1), (1)
Beacon