Zinc Finger Protein 800 (ZNF800) antibody

Antigen: Zinc Finger Protein 800 (ZNF800)

Synonyms: RGD1560157

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Rabbit, Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN501911

Additional Information

Alternative name: ZNF800

Gene ID: ZNF800

UniProt: Q2TB10

Immunogen: The immunogen for anti-ZNF800 antibody: synthetic peptide directed towards the N terminal of human ZNF800

Sequence: MPLRDKYCQTDHHHHGCCEPVYILEPGDPPLLQQPLQTSK SGIQQIIECF

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rabbit, Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF800 antibody concentration is 1 mg/ml.

Description: ZNF800 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 7 C2H2-type zinc fingers. ZNF800 may be involved in transcriptional regulation.

Characteristics: Antigen Size: 664 amino acids

Molecular Weight: 75kDa

Application Details

Application Notes: WB Suggested Anti-ZNF800 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Small Intestine.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF800 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Small Intestine

Publications

Product: Denoeud, Kapranov, Ucla et al.: "Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions." in: Genome research, Vol. 17, Issue 6, pp. 746-59, 2007 (PubMed).