Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Zinc Finger Protein 800 (ZNF800) antibody

Antigen

Zinc Finger Protein 800 (ZNF800)

Synonyms RGD1560157
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Rabbit, Zebrafish

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN501911
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name ZNF800
Gene ID ZNF800
UniProt Q2TB10
Immunogen The immunogen for anti-ZNF800 antibody: synthetic peptide directed towards the N terminal of human ZNF800
Sequence MPLRDKYCQTDHHHHGCCEPVYILEPGDPPLLQQPLQTSK SGIQQIIECF
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rabbit, Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-ZNF800 antibody concentration is 1 mg/ml.
Description ZNF800 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 7 C2H2-type zinc fingers. ZNF800 may be involved in transcriptional regulation.
Characteristics Antigen Size: 664 amino acids
Molecular Weight 75kDa

Application Details

Application Notes WB Suggested Anti-ZNF800 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Small Intestine.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only

Publications

Product Denoeud, Kapranov, Ucla et al.: "Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions." in: Genome research, Vol. 17, Issue 6, pp. 746-59, 2007 (PubMed).

Alternatives

Alternatives for antigen "Zinc Finger Protein 800 (ZNF800)", type "Antibodies"
Hosts Rabbit (5)
Reactivities Human (5), Cow (Bovine) (1), Dog (Canine) (1), Mouse (Murine) (1), Rabbit (1), Rat (Rattus) (1)
Applications Western Blotting (WB) (5), ELISA (3), Flow Cytometry (FACS) (1)
Epitopes N-Term (2), C-Term (1)