Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501913

Zinc Finger Protein 827 (ZNF827) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2810449M09Rik, D630040G17Rik, Znf827
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501913
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF827 antibody: synthetic peptide directed towards the middle region of human LOC152485
Sequence VCKTKNMFERHLQIHLITRMFECDVCHKFMKTPEQLLEHK KCHTVPTGGL
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Rabbit : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against LOC152485. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF827
Background The functions of this protein remains unknown.
Molecular Weight 119kDa
Gene ID 152485
NCBI Accession NP_849157, NM_178835
UniProt Q17R98-2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF827 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Bubb, Bovee, Buckley et al.: "Scan of human genome reveals no new Loci under ancient balancing selection." in: Genetics, Vol. 173, Issue 4, pp. 2165-77, 2006 (PubMed).

Alternatives for antigen "Zinc Finger Protein 827 (ZNF827)", type "Antibodies"
Hosts (1)
Reactivities (1)
Applications (1), (1)
Epitopes (1)
Beacon