Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Zinc Finger and BTB Domain Containing 12 (ZBTB12) antibody

Antigen

Zinc Finger and BTB Domain Containing 12 (ZBTB12)

Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Xenopus laevis

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN501916
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name ZBTB12
Gene ID ZBTB12
UniProt Q9Y330
Immunogen The immunogen for anti-ZBTB12 antibody: synthetic peptide directed towards the N terminal of human ZBTB12
Sequence MASGVEVLRFQLPGHEAATLRNMNQLRAEERFCDVTIVAD SLKFRGHKVI
Cross-Reactivity Cow (Bovine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-ZBTB12 antibody concentration is 1 mg/ml.
Description ZBTB12 may be involved in transcriptional regulation.
Characteristics Antigen Size: 459 amino acids
Molecular Weight 49kDa

Application Details

Application Notes WB Suggested Anti-ZBTB12 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: PANC1 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Xie, Rowen, Aguado et al.: "Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse." in: Genome research, Vol. 13, Issue 12, pp. 2621-36, 2003 (PubMed).

Alternatives

Alternatives for antigen "Zinc Finger and BTB Domain Containing 12 (ZBTB12)", type "Antibodies"
Hosts Rabbit (4)
Reactivities Human (4), Rat (Rattus) (1)
Applications Western Blotting (WB) (4), ELISA (1)
Epitopes C-Term,AA 412-440 (1), Middle Region (1), N-Term (1)