Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 778 (ZNF778) (N-Term) antibody

Details for Product No. ABIN501918
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
(3), (1)
Reactivity
Human
(7), (1), (1)
Host
Rabbit
(7)
Clonality
Polyclonal
Application
Western Blotting (WB)
(7)
Pubmed 2 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501918
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF778
Sequence MAAPDLAHGGHVSRDSVCLHEEQTQAAGMVAGWLINCYQD AVTFDDVAVD
Predicted Reactivity Human :100 %
Characteristics This is a rabbit polyclonal antibody against ZNF778. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF778
Background ZNF778 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 19 C2H2-type zinc fingers and 1 KRAB domain. ZNF778 may be involved in transcriptional regulation.
Molecular Weight 82 kDa
Gene ID 197320
NCBI Accession NM_182531, NP_872337
UniProt Q96MU6
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 729 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 778 (ZNF778) (N-Term) antibody WB Suggested Anti-ZNF778 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: PANC1 cell lysate
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Talmud, Drenos, Shah et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Validation Images
back to top