Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 778 (ZNF778) (N-Term) antibody

Details for Product No. ABIN501918
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
(3), (1)
Reactivity
Human
(7), (1), (1)
Host
Rabbit
(7)
Clonality
Polyclonal
Application
Western Blotting (WB)
(7)
Pubmed 2 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN501918
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF778
Sequence MAAPDLAHGGHVSRDSVCLHEEQTQAAGMVAGWLINCYQD AVTFDDVAVD
Predicted Reactivity Human :100 %
Characteristics This is a rabbit polyclonal antibody against ZNF778. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF778
Background ZNF778 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 19 C2H2-type zinc fingers and 1 KRAB domain. ZNF778 may be involved in transcriptional regulation.
Molecular Weight 82 kDa
Gene ID 197320
NCBI Accession NM_182531, NP_872337
UniProt Q96MU6
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 729 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 778 (ZNF778) (N-Term) antibody WB Suggested Anti-ZNF778 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: PANC1 cell lysate
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Talmud, Drenos, Shah et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Hosts (7)
Reactivities (7), (1), (1)
Applications (7)
Epitopes (3), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501918
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top