Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 713 (ZNF713) (Middle Region) antibody

Details for Product No. ABIN501919
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF713
Epitope
Middle Region
(7), (7), (4), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Human
(13)
Host
Rabbit
(12), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(13), (6), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN501919
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZNF713
Sequence TGEKPYKCNECGKAFSQSAHLNQHRKIHTREKLCEYKCEQ TVRHSPSFSS
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Pig : 100 %, Rabbit : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF713. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF713
Background ZNF713 is a new candidate transcription factor.
Molecular Weight 50 kDa
Gene ID 349075
NCBI Accession NM_182633, NP_872439
UniProt Q8N859
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 430 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501919
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top