Actin, beta (ACTB) antibody

Antigen: Actin, beta (ACTB)

Synonyms: PS1TP5BP1, Actx, beta-actin, E430023M04Rik, ACTB, MGC128179, MGC76228, MGC79692, MGC88999, ps1tp5bp1, LOC442937, LOC563571, A26C1A, A26C1B, ACT-5, act-2, Actb, actb, B-actin, LOC100136013, DKFZp459A196, LOC100174883, LOC100304816, ACTA1

Clonality: Polyclonal

Host: Rabbit

Reactivity: Caenorhabditis elegans (C. elegans), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Fruit Fly (Drosophila melanogaster)

Conjugate: Un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN501930

Additional Information

Alternative name: Actin beta / ACTB

Gene ID: ACTB

UniProt: P60709

Immunogen: The immunogen for anti-ACTB antibody: synthetic peptide directed towards the middle region of human ACTB

Sequence: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYD ESGPSIVHRK

Cross-Reactivity: Caenorhabditis elegans (C. elegans), Dog (Canine), Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ACTB antibody concentration is 1 mg/ml.

Description: This protein is one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, and integrity. This actin is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins.This gene encodes one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, and integrity. This actin is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 375 amino acids

Molecular Weight: 42kDa

Synonyms: PS1TP5BP1, Actx, beta-actin, E430023M04Rik, ACTB, MGC128179, MGC76228, MGC79692, MGC88999, ps1tp5bp1, LOC442937, LOC563571, A26C1A, A26C1B, ACT-5, act-2, Actb, actb, B-actin, LOC100136013, DKFZp459A196, LOC100174883, LOC100304816, ACTA1

Application Details

Application Notes: WB Suggested Anti-ACTB Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ACTB Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T

Sample type: 1-8.N2 WT C elegans (60ug)
Primary Dilution: 1:2000
Secondary Antibody: goat anti-Rabbit HRP
Secondary Dilution: 1:2000

Sample Type: NT2 cells
Red: Antibody
Blue: DAPI
Primary Dilution: 1ug/50ul antibody
Secondary Antibody: Alexa goat anti-rabbit 594
Image Submitted by: Yuzhi Chen, University of Arkansas for Medical Sciences

Publications

Product: Rinne, Clements, Lamme et al.: "A novel translation re-initiation mechanism for the p63 gene revealed by amino-terminal truncating mutations in Rapp-Hodgkin/Hay-Wells-like syndromes." in: Human molecular genetics, Vol. 17, Issue 13, pp. 1968-77, 2008 (PubMed).