Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501945

Poly(A) Binding Protein, Cytoplasmic 1-Like 2A (PABPC1L2A) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RBM32A
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Fruit Fly (Drosophila melanogaster), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501945
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PABPC1L2A antibody: synthetic peptide directed towards the middle region of human PABPC1L2A
Sequence NGMFLNYRKIFVGRFKSHKEREAERGAWARQSTSADVKDF EEDTDEEATL
Predicted Reactivity Bovine : 100%
Characteristics This is a rabbit polyclonal antibody against PABPC1L2A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PABPC1L2A
Background The function of this protein remains unknown.
Molecular Weight 23kDa
Gene ID 340529
NCBI Accession NP_001012995, NM_001012977
UniProt Q5JQF8
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PABPC1L2A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives for antigen "Poly(A) Binding Protein, Cytoplasmic 1-Like 2A (PABPC1L2A)", type "Antibodies"
Hosts (3)
Reactivities (2)
Applications (3)
Epitopes (1), (1), (1)
Beacon