LSM6 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae) (LSM6) antibody

Antigen: LSM6 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae) (LSM6)

Synonyms: YDR378C, SMF, Sm-F, lsm6

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Zebrafish, Xenopus laevis, Dog (Canine), Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN502009

Additional Information

Alternative name: LSM6

Gene ID: LSM6

UniProt: P62312

Immunogen: The immunogen for anti-LSM6 antibody: synthetic peptide directed towards the N terminal of human LSM6

Sequence: MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGY MNIALEQTEE

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-LSM6 antibody concentration is 1 mg/ml.

Description: Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2, MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2, MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM].

Characteristics: Antigen Size: 80 amino acids

Molecular Weight: 9kDa

Application Details

Application Notes: WB Suggested Anti-LSM6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA

Restrictions: For Research Use only

Images

WB Suggested Anti-LSM6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T

Publications

Product: Lehner, Sanderson: "A protein interaction framework for human mRNA degradation." in: Genome research, Vol. 14, Issue 7, pp. 1315-23, 2004 (PubMed).