Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502017

Family with Sequence Similarity 156, Member A (FAM156A) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PRO0659, TMEM29
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502017
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FAM156A antibody: synthetic peptide directed towards the N terminal of human FAM156A
Sequence DPLQKRNPASPSKSSPMTAAETSQEGPAPSQPSYSEQPMM GLSNLSPGPG
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against FAM156A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name FAM156A
Background The exact function of FAM156A remains unknown.
Molecular Weight 24kDa
Gene ID 29057
NCBI Accession NP_054857, NM_014138
UniProt B3KQ92
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FAM156A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives for antigen "Family with Sequence Similarity 156, Member A (FAM156A)", type "Antibodies"
Hosts (8)
Reactivities (6)
Applications (6), (5), (2)
Epitopes (2), (1), (1)
Beacon