Family with Sequence Similarity 156, Member A (FAM156A) (N-Term) antibody

Details for Product No. ABIN502017
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms PRO0659, TMEM29
Epitope
N-Term
(1), (1), (1)
Reactivity
Human
(5)
Host
Rabbit
(7)
Clonality
Polyclonal
Application
Western Blotting (WB)
(5), (2), (2)
Pubmed 1 reference available
Catalog no. ABIN502017
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human FAM156A
Sequence DPLQKRNPASPSKSSPMTAAETSQEGPAPSQPSYSEQPMM GLSNLSPGPG
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against FAM156A. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FAM156A
Background The exact function of FAM156A remains unknown.
Molecular Weight 24 kDa
Gene ID 29057
NCBI Accession NM_014138, NP_054857
UniProt B3KQ92
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 213 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Hosts (7)
Reactivities (5)
Applications (5), (2), (2)
Epitopes (1), (1), (1)
back to top