Family with Sequence Similarity 156, Member A (FAM156A) antibody

Antigen: Family with Sequence Similarity 156, Member A (FAM156A)

Synonyms: TMEM29, PRO0659, DKFZp686B22211

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN502017

Additional Information

Alternative name: FAM156A

Gene ID: FAM156A

UniProt: B3KQ92

Immunogen: The immunogen for anti-FAM156A antibody: synthetic peptide directed towards the N terminal of human FAM156A

Sequence: DPLQKRNPASPSKSSPMTAAETSQEGPAPSQPSYSEQPMM GLSNLSPGPG

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-FAM156A antibody concentration is 1 mg/ml.

Description: The exact function of FAM156A remains unknown.

Characteristics: Antigen Size: 213 amino acids

Molecular Weight: 24kDa

Application Details

Application Notes: WB Suggested Anti-FAM156A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Lung.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-FAM156A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Lung

Publications

Product: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).