RNA Binding Motif Protein 47 (RBM47) antibody

Antigen: RNA Binding Motif Protein 47 (RBM47)

Synonyms: MGC18900, 9530077J19Rik

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN502042

Additional Information

Alternative name: RBM47

Gene ID: RBM47

UniProt: A0AV96-2

Immunogen: The immunogen for anti-RBM47 antibody: synthetic peptide directed towards the middle region of human RBM47

Sequence: HFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDKEQYSR YQKAARGGGA

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-RBM47 antibody concentration is 1 mg/ml.

Description: The function of this protein remains unknown.

Characteristics: Antigen Size: 524 amino acids

Molecular Weight: 57kDa

Application Details

Application Notes: WB Suggested Anti-RBM47 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: NCI-H226 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-RBM47 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: NCI-H226 cell lysate

Publications

Product: Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).