Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Solute Carrier Family 22 Member 6 (SLC22A6) antibody

Antigen

Solute Carrier Family 22 Member 6 (SLC22A6)

Synonyms OAT1, PAHT, HOAT1, ROAT1, FLJ55736, MGC45260, NKT, Oat1, mOat1, Orctl1, slc22a6, MGC77073, zgc:77073, SLC22A6, DKFZp469E1633
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Rabbit, Pig (Porcine), Dog (Canine), Xenopus laevis

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN502135
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name SLC22A6 / OAT1
Gene ID SLC22A6
UniProt Q4U2R8
Immunogen The immunogen for anti-SLC22A6 antibody: synthetic peptide directed towards the N terminal of human SLC22A6
Sequence AFNDLLQQVGGVGRFQQIQVTLVVLPLLLMASHNTLQNFT AAIPTHHCRP
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Pig (Porcine), Rabbit, Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-SLC22A6 antibody concentration is 1 mg/ml.
Description SLC22A6 is involved in the sodium-dependent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and may be localized to the basolateral membrane.The protein encoded by this gene is involved in the sodium-dependent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and may be localized to the basolateral membrane. Four transcript variants encoding four different isoforms have been found for this gene.
Characteristics Antigen Size: 563 amino acids
Molecular Weight 62kDa

Application Details

Application Notes WB Suggested Anti-SLC22A6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Placenta.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Windass, Lowes, Wang et al.: "The contribution of organic anion transporters OAT1 and OAT3 to the renal uptake of rosuvastatin." in: The Journal of pharmacology and experimental therapeutics, Vol. 322, Issue 3, pp. 1221-7, 2007 (PubMed).

Alternatives

Alternatives for antigen "Solute Carrier Family 22 Member 6 (SLC22A6)", type "Antibodies"
Hosts Rabbit (53), Mouse (1)
Reactivities Human (32), Rat (Rattus) (28), Mouse (Murine) (25), Cow (Bovine) (1), Dog (Canine) (1), Pig (Porcine) (1), Rabbit (1), Zebrafish (1)
Applications Immunofluorescence (IF) (31), Western Blotting (WB) (23), ELISA (15), Immunohistochemistry (IHC) (10), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (8), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (6), Immunoelectron Microscopy (IEM) (2), Immunoprecipitation (IP) (2), Flow Cytometry (FACS) (1)
Conjugates Alexa Fluor 350 (2), Alexa Fluor 488 (2), Alexa Fluor 555 (2), Alexa Fluor 647 (2), Biotin (2), Cy3 (2), Cy5 (2), Cy5.5 (2), Cy7 (2), FITC (2), Gold (2), HRP (2), PE (2), PE,Cy3 (2), PE,Cy5 (2), PE,Cy5.5 (2), PE,Cy7 (2)
Epitopes C-Term (22), N-Term (19), Internal Region (3), C-Term,AA 520-549 (1)