Did you know that you can buy products from over 140 different suppliers from us?

Acid Phosphatase, Prostate (ACPP) (Middle Region) antibody

Details for Product No. ABIN502188
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ACPP, CD73, Nt5, 4921514H13Rik, AIRP, CN-IB, 5'-NT, ACP-3, ACP3, PAP, A030005E02Rik, FRAP, Lap, Ppal, Acpp11, RNACPP11, pap, acp-3, acp3, acpt, AMAP2, CENTB3, DDEF2, PAG3, Pap-alpha, SHAG1
Epitope
Middle Region
(7), (5), (2), (2), (2), (2), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(102), (24), (19), (13), (4), (1)
Host
Rabbit
(45), (43), (15), (6), (2), (1), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(5), (4), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(44), (42), (35), (25), (13), (12), (10), (6), (4), (2), (2), (2), (2), (2), (2), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502188
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ACPP
Sequence CESVHNFTLPSWATEDTMTKLRELSELSLLSLYGIHKQKE KSRLQGGVLV
Predicted Reactivity Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Rabbit : 100 %, Rat : 100 %, Chicken : 90 %, Horse : 90 %
Characteristics This is a rabbit polyclonal antibody against ACPP. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ACPP
Background This gene encodes an enzyme that catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is synthesized under androgen regulation and is secreted by the epithelial cells of the prostate gland. An alternatively spliced trans
Molecular Weight 41 kDa
Gene ID 55
NCBI Accession NM_001099, NP_001090
UniProt P15309
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 386 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Acid Phosphatase, Prostate (ACPP) (Middle Region) antibody WB Suggested Anti-ACPP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: NCI-H226 cell lysate
Background publications Quintero, Araujo, Pulkka et al.: "Prostatic acid phosphatase is not a prostate specific target." in: Cancer research, Vol. 67, Issue 14, pp. 6549-54, 2007 (PubMed).

Validation Images
back to top