Glutaminyl-tRNA Synthase (Glutamine-Hydrolyzing)-Like 1 (QRSL1) antibody

Antigen: Glutaminyl-tRNA Synthase (Glutamine-Hydrolyzing)-Like 1 (QRSL1)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN502267

Additional Information

Alternative name: QRSL1

Gene ID: QRSL1

UniProt: Q9H0R6

Immunogen: The immunogen for anti-QRSL1 antibody: synthetic peptide directed towards the N terminal of human QRSL1

Sequence: SYSKQYREKRKQNPHSENEDSDWLITGGSSGGSAAAVSAF TCYAALGSDT

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-QRSL1 antibody concentration is 1 mg/ml.

Description: The function of the QRSL1 protein remains unknown.

Characteristics: Antigen Size: 528 amino acids

Molecular Weight: 57kDa

Application Details

Application Notes: WB Suggested Anti-QRSL1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HT1080 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-QRSL1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HT1080 cell lysate

Publications

Product: Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).